HORDB

ID: hor000185
Uniprot ID: P19806
Protein name: CHH precursor-related peptide A
Gene name: NA
Organism: Homarus americanus (American lobster)
Family: Arthropod CHH/MIH/GIH/VIH hormone family
Source: Animal
Expression: Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released. Present also in the ventral nervous system.
Disease: NA
Comments: NA
Taxonomy: Homarus (genus), Nephropidae (family), Nephropoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: RSVEGASRMEKLLSSSNSPSSTPLGFLSQDHSVN
Length: 34(25-58)
Propeptide: MMACRTLCLVVVMVASLGTSGVGGRSVEGASRMEKLLSSSNSPSSTPLGFLSQDHSVNKRQVFDQACKGVYDRNLFKKLDRVCEDCYNLYRKPFVATTCRENCYSNWVFRQCLDDLLLSDVIDEYVSNVQMVGK
Signal peptide: MMACRTLCLVVVMVASLGTSGVGG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: CHH is the most abundant hormone in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
Kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000185_AF2.pdb

hor000185_ESM.pdb

Mass:	419469	Formula:	C150H246N46O55S
Absent amino acids:	CIWY	Common amino acids:	S
pI:	7.55	Basic residues:	4
Polar residues:	15	Hydrophobic residues:	8
Hydrophobicity:	-57.94	Boman Index:	-8100
Half-Life / Aliphatic Index:	1 hour	Aliphatic Index:	65.88
Instability Index:	6994.71	Extinction Coefficient cystines:	0
Absorbance 280nm:	0